Human UL111A protein

Artikelnummer: BYT-ORB358430
Artikelname: Human UL111A protein
Artikelnummer: BYT-ORB358430
Hersteller Artikelnummer: orb358430
Alternativnummer: BYT-ORB358430-20,BYT-ORB358430-100,BYT-ORB358430-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Short name, cmvIL-10 Short name, vIL-10
This Human UL111A protein spans the amino acid sequence from region 20-175aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34 kDa
UniProt: P17150
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Anwendungsbeschreibung: Biological Origin: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.