Mouse Ly96 protein

Artikelnummer: BYT-ORB358436
Artikelname: Mouse Ly96 protein
Artikelnummer: BYT-ORB358436
Hersteller Artikelnummer: orb358436
Alternativnummer: BYT-ORB358436-20,BYT-ORB358436-100,BYT-ORB358436-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Short name, Ly-96 Alternative name(s), ESOP-1 Protein MD-2
This Mouse Ly96 protein spans the amino acid sequence from region 19-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.4 kDa
UniProt: Q9JHF9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.