Fungi CDC19 protein
Artikelnummer:
BYT-ORB358471
- Bilder (3)
| Artikelname: | Fungi CDC19 protein |
| Artikelnummer: | BYT-ORB358471 |
| Hersteller Artikelnummer: | orb358471 |
| Alternativnummer: | BYT-ORB358471-20,BYT-ORB358471-100,BYT-ORB358471-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | cell division cycle protein 19 |
| This Fungi CDC19 protein spans the amino acid sequence from region 2-500aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 56.4 kDa |
| UniProt: | P00549 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SRLERLTSLNVVAGSDLRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDYPIPPNHEMIFTTDDKYAKACDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVNLPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVKIENQQGVNNFDEILKV |
| Anwendungsbeschreibung: | Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: This is His-tag protein |



