Bacterial tmk protein

Artikelnummer: BYT-ORB358561
Artikelname: Bacterial tmk protein
Artikelnummer: BYT-ORB358561
Hersteller Artikelnummer: orb358561
Alternativnummer: BYT-ORB358561-20,BYT-ORB358561-100,BYT-ORB358561-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Thymidine monophosphate kinase dTMP kinase Short name, TMPK
This Bacterial tmk protein spans the amino acid sequence from region 1-214aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.6 kDa
UniProt: P9WKE0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) tmk.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) tmk.