Human GLS2 protein
Artikelnummer:
BYT-ORB358576
- Bilder (3)
| Artikelname: | Human GLS2 protein |
| Artikelnummer: | BYT-ORB358576 |
| Hersteller Artikelnummer: | orb358576 |
| Alternativnummer: | BYT-ORB358576-20,BYT-ORB358576-100,BYT-ORB358576-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | L-glutaminase L-glutamine amidohydrolase |
| This Human GLS2 protein spans the amino acid sequence from region 15-602aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 80.7 kDa |
| UniProt: | Q9UI32 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNA |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein |



