Rat Allergen Phl p Vb protein

Artikelnummer: BYT-ORB358650
Artikelname: Rat Allergen Phl p Vb protein
Artikelnummer: BYT-ORB358650
Hersteller Artikelnummer: orb358650
Alternativnummer: BYT-ORB358650-20,BYT-ORB358650-100,BYT-ORB358650-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Phl p Vb Allergen, Phl p 5b
This Rat Allergen Phl p Vb protein spans the amino acid sequence from region 20-284aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 42.1 kDa
UniProt: Q40963
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Phleum pratense (Common timothy)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGA
Anwendungsbeschreibung: Biological Origin: Phleum pratense (Common timothy). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phleum pratense (Common timothy) Phl p 5b.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phleum pratense (Common timothy) Phl p 5b.