Bacterial fbpC protein

Artikelnummer: BYT-ORB358762
Artikelname: Bacterial fbpC protein
Artikelnummer: BYT-ORB358762
Hersteller Artikelnummer: orb358762
Alternativnummer: BYT-ORB358762-20,BYT-ORB358762-100,BYT-ORB358762-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex C Short name, 85C Short name, Ag85C Fibronectin-binding protein C Short name, Fbps C
This Bacterial fbpC protein spans the amino acid sequence from region 46-340aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 36.1 kDa
UniProt: P9WQN8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpC.