Mouse Bcl2 protein

Artikelnummer: BYT-ORB382940
Artikelname: Mouse Bcl2 protein
Artikelnummer: BYT-ORB382940
Hersteller Artikelnummer: orb382940
Alternativnummer: BYT-ORB382940-20,BYT-ORB382940-100,BYT-ORB382940-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Bcl2, Bcl-2, Apoptosis regulator Bcl-2
This Mouse Bcl2 protein spans the amino acid sequence from region 5-205aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.7 kDa
UniProt: P10417
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.