Human CASP14 protein

Artikelnummer: BYT-ORB382944
Artikelname: Human CASP14 protein
Artikelnummer: BYT-ORB382944
Hersteller Artikelnummer: orb382944
Alternativnummer: BYT-ORB382944-20,BYT-ORB382944-100,BYT-ORB382944-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Apoptosis related cysteine protease, CASP 14, CASP-14, CASP14, Caspase 14 apoptosis related cysteine protease, Caspase 14 precursor, Caspase-14 subunit p10, Caspase14, CASPE_HUMAN, MGC119078, MGC119079, MICE, Mini ICE
This Human CASP14 protein spans the amino acid sequence from region 153-240aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 37.2 kDa
UniProt: P31944
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal GST-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.