Human FCER1G protein

Artikelnummer: BYT-ORB382950
Artikelname: Human FCER1G protein
Artikelnummer: BYT-ORB382950
Hersteller Artikelnummer: orb382950
Alternativnummer: BYT-ORB382950-20,BYT-ORB382950-100,BYT-ORB382950-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Fc receptor gamma-chain , FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma , FceRI gamma
This Human FCER1G protein spans the amino acid sequence from region 19-86aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34.8 kDa
UniProt: P30273
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal GST-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.