Human KCND1 protein

Artikelnummer: BYT-ORB382956
Artikelname: Human KCND1 protein
Artikelnummer: BYT-ORB382956
Hersteller Artikelnummer: orb382956
Alternativnummer: BYT-ORB382956-20,BYT-ORB382956-100,BYT-ORB382956-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Voltage-gated potassium channel subunit Kv4.1
This Human KCND1 protein spans the amino acid sequence from region 410-647aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.7 kDa
UniProt: Q9NSA2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Cytoplasmic Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.