Human ANGPT2 protein

Artikelnummer: BYT-ORB382990
Artikelname: Human ANGPT2 protein
Artikelnummer: BYT-ORB382990
Hersteller Artikelnummer: orb382990
Alternativnummer: BYT-ORB382990-20,BYT-ORB382990-100,BYT-ORB382990-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: AGPT 2, Agpt2, ANG 2, ANG-2, ANG2, Angiopoietin 2a, Angiopoietin 2B, Angiopoietin-2, Angiopoietin2, ANGP2_HUMAN, ANGPT 2, Angpt2, Tie2 ligand
This Human ANGPT2 protein spans the amino acid sequence from region 19-485aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 55.7 kDa
UniProt: O15123
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.