Human BTC protein

Artikelnummer: BYT-ORB382991
Artikelname: Human BTC protein
Artikelnummer: BYT-ORB382991
Hersteller Artikelnummer: orb382991
Alternativnummer: BYT-ORB382991-20,BYT-ORB382991-100,BYT-ORB382991-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: BTCProbetacellulin [Cleaved into, Betacellulin, BTC)]
This Human BTC protein spans the amino acid sequence from region 32-178aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.6 kDa
UniProt: P35070
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.The reducing (R) protein migrates as 45 kDa in SDS-PAGE may be due to glycosylation.