Human CCL18 protein

Artikelnummer: BYT-ORB382992
Artikelname: Human CCL18 protein
Artikelnummer: BYT-ORB382992
Hersteller Artikelnummer: orb382992
Alternativnummer: BYT-ORB382992-20,BYT-ORB382992-100,BYT-ORB382992-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Alternative macrophage activation-associated CC chemokine 1 , AMAC-1CC chemokine PAR, CDendritic cell chemokine 1 , DC-CK1Macrophage inflammatory protein 4 , MIP-4Pulmonary and activation-regulated chemokine, Small-inducible cytokine A18
This Human CCL18 protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 9.9 kDa
UniProt: P55774
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.