Fungi HXK1 protein

Artikelnummer: BYT-ORB382995
Artikelname: Fungi HXK1 protein
Artikelnummer: BYT-ORB382995
Hersteller Artikelnummer: orb382995
Alternativnummer: BYT-ORB382995-20,BYT-ORB382995-100,BYT-ORB382995-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Hexokinase PIHexokinase-A
This Fungi HXK1 protein spans the amino acid sequence from region 2-485aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 55.6 kDa
UniProt: P04806
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELNKGLTKKGGNIPMIPGWVMEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRTTKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTFSYPASQNKINEGILQRWTKGFDIPNVEGHDVVPLLQNEISKRELPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAFYDVVSDIEKLEGKLAD
Anwendungsbeschreibung: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.