Human KCNJ1 protein

Artikelnummer: BYT-ORB382996
Artikelname: Human KCNJ1 protein
Artikelnummer: BYT-ORB382996
Hersteller Artikelnummer: orb382996
Alternativnummer: BYT-ORB382996-20,BYT-ORB382996-100,BYT-ORB382996-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ATP-regulated potassium channel ROM-KInward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1
This Human KCNJ1 protein spans the amino acid sequence from region 178-391. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.3 kDa
UniProt: P48048
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Cytoplasmic Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.