Yeast CDA2 protein

Artikelnummer: BYT-ORB383008
Artikelname: Yeast CDA2 protein
Artikelnummer: BYT-ORB383008
Hersteller Artikelnummer: orb383008
Alternativnummer: BYT-ORB383008-20,BYT-ORB383008-100,BYT-ORB383008-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CDA2, YLR308W, L2142.1Chitin deacetylase 2, EC 3.5.1.41
This Yeast CDA2 protein spans the amino acid sequence from region 26-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34.9 kDa
UniProt: Q06703
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EANREDLKQIDFQFPVLERAATKTPFPDWLSAFTGLKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTV
Anwendungsbeschreibung: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.