Animal Hirudin variant-1 protein

Artikelnummer: BYT-ORB383017
Artikelname: Animal Hirudin variant-1 protein
Artikelnummer: BYT-ORB383017
Hersteller Artikelnummer: orb383017
Alternativnummer: BYT-ORB383017-20,BYT-ORB383017-100,BYT-ORB383017-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Hirudin variant-1, Hirudin-1, Hirudin-I, Lepirudin
This Animal Hirudin variant-1 protein spans the amino acid sequence from region 1-65aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 9 kDa
UniProt: P01050
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Hirudo medicinalis (Medicinal leech)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Anwendungsbeschreibung: Biological Origin: Hirudo medicinalis (Medicinal leech). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.