Bacterial MPN_083 protein

Artikelnummer: BYT-ORB383032
Artikelname: Bacterial MPN_083 protein
Artikelnummer: BYT-ORB383032
Hersteller Artikelnummer: orb383032
Alternativnummer: BYT-ORB383032-20,BYT-ORB383032-100,BYT-ORB383032-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uncharacterized lipoprotein MPN_083
This Bacterial MPN_083 protein spans the amino acid sequence from region 22-242aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.2 kDa
UniProt: P75610
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CSFKDYIPTPSFRKDFSTENNFVKNKVPGKDDIYSKFYDLTFSLNFVNNQAQEFGTGWLIDWKGDENKNLSKNKEGQTASQTRSSSEQTTDQDANLFTAYIATNLHVADGLKNDQDYAPYNKDGWGQPYPYQQKTQSFLLGKYTKPNVQLVKTNYEKPEDAVIEQKLKEDSLLFIQTSTLPKTAYAAIDPVNFSYNPTRTNGFWTAGKYNVYNGGNSIGNY
Anwendungsbeschreibung: Biological Origin: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.