Human CYP21A2 protein

Artikelnummer: BYT-ORB383039
Artikelname: Human CYP21A2 protein
Artikelnummer: BYT-ORB383039
Hersteller Artikelnummer: orb383039
Alternativnummer: BYT-ORB383039-20,BYT-ORB383039-100,BYT-ORB383039-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 21-OHase Cytochrome P-450c21 Cytochrome P450 21 Cytochrome P450 XXI Cytochrome P450-C21 Cytochrome P450-C21B
This Human CYP21A2 protein spans the amino acid sequence from region 1-494aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 57.9 kDa
UniProt: P08686
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLLLGLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWRD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.