Plant Allergen Pla a 1 protein

Artikelnummer: BYT-ORB383040
Artikelname: Plant Allergen Pla a 1 protein
Artikelnummer: BYT-ORB383040
Hersteller Artikelnummer: orb383040
Alternativnummer: BYT-ORB383040-20,BYT-ORB383040-100,BYT-ORB383040-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pollen allergen Pla a 1 Allergen, Pla a 1
This Plant Allergen Pla a 1 protein spans the amino acid sequence from region 24-179aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.6 kDa
UniProt: Q8GT41
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: London plane tree
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA
Anwendungsbeschreibung: Biological Origin: London plane tree. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.