Human FAM150A protein

Artikelnummer: BYT-ORB383042
Artikelname: Human FAM150A protein
Artikelnummer: BYT-ORB383042
Hersteller Artikelnummer: orb383042
Alternativnummer: BYT-ORB383042-20,BYT-ORB383042-100,BYT-ORB383042-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ALKAL1, FAM150A, UNQ9433/PRO34745ALK and LTK ligand 1, Augmentor beta, AUG-beta, Protein FAM150A
This Human FAM150A protein spans the amino acid sequence from region 28-129. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 25.5 kDa
UniProt: Q6UXT8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.