Human CYP11B2 protein

Artikelnummer: BYT-ORB383061
Artikelname: Human CYP11B2 protein
Artikelnummer: BYT-ORB383061
Hersteller Artikelnummer: orb383061
Alternativnummer: BYT-ORB383061-20,BYT-ORB383061-100,BYT-ORB383061-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Aldosterone synthase (EC, 1.14.15.4, EC, 1.14.15.5) Short name, ALDOS Aldosterone-synthesizing enzyme CYPXIB2 Cytochrome P-450Aldo Cytochrome P-450C18 Steroid 18-hydroxylase
This Human CYP11B2 protein spans the amino acid sequence from region 25-503. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 71 kDa
UniProt: P19099
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.