Viral ORF3 protein

Artikelnummer: BYT-ORB383067
Artikelname: Viral ORF3 protein
Artikelnummer: BYT-ORB383067
Hersteller Artikelnummer: orb383067
Alternativnummer: BYT-ORB383067-20,BYT-ORB383067-100,BYT-ORB383067-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Coat protein Short name, CP
This Viral ORF3 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27.2 kDa
UniProt: P17521
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK
Anwendungsbeschreibung: Biological Origin: Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.