Mouse Thy1 protein

Artikelnummer: BYT-ORB383068
Artikelname: Mouse Thy1 protein
Artikelnummer: BYT-ORB383068
Hersteller Artikelnummer: orb383068
Alternativnummer: BYT-ORB383068-20,BYT-ORB383068-100,BYT-ORB383068-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Thy-1 antigen CD_antigen, CD90
This Mouse Thy1 protein spans the amino acid sequence from region 20-131aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.8 kDa
UniProt: P01831
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.