Human AIMP2 protein

Artikelnummer: BYT-ORB383073
Artikelname: Human AIMP2 protein
Artikelnummer: BYT-ORB383073
Hersteller Artikelnummer: orb383073
Alternativnummer: BYT-ORB383073-20,BYT-ORB383073-100,BYT-ORB383073-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Multisynthase complex auxiliary component p38 Protein JTV-1
This Human AIMP2 protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.3 kDa
UniProt: Q13155
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.