Dog DMP1 protein

Artikelnummer: BYT-ORB383081
Artikelname: Dog DMP1 protein
Artikelnummer: BYT-ORB383081
Hersteller Artikelnummer: orb383081
Alternativnummer: BYT-ORB383081-20,BYT-ORB383081-100,BYT-ORB383081-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Dog DMP1 protein spans the amino acid sequence from region 1-435aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 63.5 kDa
UniProt: F1PHT7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MHRPAGGLSRSGGKEGDDKDDDEDDSGDDTFGDDDNGPGPEERQGGKSRLKSNEDSADSTQSREDSPSLGEDSAQDTTSESRDLDNEDEMNSSPERGDSVQESESKEHWVGGGSEGDSSHGDGSEFGDEEMQNDDPDTIRNERGNSRMNSASVKSEESKGNSDEQASTQDSGDSQSMEYPRRKIFRKSRISEEDDIGELDDSNTMEEVKSDSTENANSKETGLSQSRENSESESVEESEENQSQEDSQNIQDPSS
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.