Rat Dpp4 protein

Artikelnummer: BYT-ORB383085
Artikelname: Rat Dpp4 protein
Artikelnummer: BYT-ORB383085
Hersteller Artikelnummer: orb383085
Alternativnummer: BYT-ORB383085-20,BYT-ORB383085-100,BYT-ORB383085-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name, DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen, CD26 Cleaved into the following 3 chains, Dipeptidyl peptidase 4 membrane form Alternative name(s), Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s), Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name(s), Dipeptidyl peptidase IV 60KDA soluble form
This Rat Dpp4 protein spans the amino acid sequence from region 638-767aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.7 kDa
UniProt: P14740
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.