Human GLI2 protein

Artikelnummer: BYT-ORB383091
Artikelname: Human GLI2 protein
Artikelnummer: BYT-ORB383091
Hersteller Artikelnummer: orb383091
Alternativnummer: BYT-ORB383091-20,BYT-ORB383091-100,BYT-ORB383091-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GLI family zinc finger protein 2 Tax helper protein
This Human GLI2 protein spans the amino acid sequence from region 412-641aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.5 kDa
UniProt: P10070
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.