Human CD1C protein

Artikelnummer: BYT-ORB383095
Artikelname: Human CD1C protein
Artikelnummer: BYT-ORB383095
Hersteller Artikelnummer: orb383095
Alternativnummer: BYT-ORB383095-20,BYT-ORB383095-100,BYT-ORB383095-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: BDCA1, CD1, CD1A, CD1c, CD1c antigen, CD1C antigen c polypeptide, CD1c molecule, CD1C_HUMAN, Cortical thymocyte antigen CD1C, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1c
This Human CD1C protein spans the amino acid sequence from region 18-302aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34.2 kDa
UniProt: P29017
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVAS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.