Human RUVBL2 protein

Artikelnummer: BYT-ORB383108
Artikelname: Human RUVBL2 protein
Artikelnummer: BYT-ORB383108
Hersteller Artikelnummer: orb383108
Alternativnummer: BYT-ORB383108-20,BYT-ORB383108-100,BYT-ORB383108-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 48KDA TATA box-binding protein-interacting protein Short name, 48KDA TBP-interacting protein 51KDA erythrocyte cytosolic protein Short name, ECP-51 INO80 complex subunit J Repressing pontin 52 Short name, Reptin 52 TIP49b TIP60-associated protein 54-beta Short name, TAP54-beta
This Human RUVBL2 protein spans the amino acid sequence from region 2-463aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 67 kDa
UniProt: Q9Y230
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.