Mouse Aimp1 protein

Artikelnummer: BYT-ORB383109
Artikelname: Mouse Aimp1 protein
Artikelnummer: BYT-ORB383109
Hersteller Artikelnummer: orb383109
Alternativnummer: BYT-ORB383109-20,BYT-ORB383109-100,BYT-ORB383109-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Multisynthase complex auxiliary component p43 Cleaved into the following chain, Endothelial monocyte-activating polypeptide 2 Short name, EMAP-2 Alternative name(s), Endothelial monocyte-activating polypeptide II Short name, EMAP-II Small inducible cytokine subfamily E member 1
This Mouse Aimp1 protein spans the amino acid sequence from region 2-310aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 49.9 kDa
UniProt: P31230
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATNDAVLKRLEQKGAEADQIIEYLKQQVALLKEKAILQATMREEKKLRVENAKLKKEIEELKQELILAEIHNGVEQVRVRLSTPLQTNCTASESVVQSPSVATTASPATKEQIKAGEEKKVKEKTEKKGEKKEKQQSAAASTDSKPIDASRLDLRIGCIVTAKKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEKVEILAPPNGSVPGDRITFDAFPG
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.