Viral NP protein

Artikelnummer: BYT-ORB383113
Artikelname: Viral NP protein
Artikelnummer: BYT-ORB383113
Hersteller Artikelnummer: orb383113
Alternativnummer: BYT-ORB383113-20,BYT-ORB383113-100,BYT-ORB383113-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nucleocapsid protein Short name, Protein N
This Viral NP protein spans the amino acid sequence from region 1-498aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 72.1 kDa
UniProt: P18071
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Influenza A virus (strain A/Fort Warren/1/1950 H1N1)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASQGTKRSYEQMETDGDRQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVLYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIED
Anwendungsbeschreibung: Biological Origin: Influenza A virus (strain A/Fort Warren/1/1950 H1N1). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Fort Warren/1/1950 H1N1) NP.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Fort Warren/1/1950 H1N1) NP.