Human XI protein

Artikelnummer: BYT-ORB383130
Artikelname: Human XI protein
Artikelnummer: BYT-ORB383130
Hersteller Artikelnummer: orb383130
Alternativnummer: BYT-ORB383130-20,BYT-ORB383130-100,BYT-ORB383130-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: COBA1_HUMAN, COL11A1, COLL6, Collagen alpha 1, Collagen alpha-1(XI) chain, collagen XI alpha 1, collagen XI, alpha 1 polypeptide , collagen, type XI, alpha 1, STL2, STL3, XI chain precursor
This Human XI protein spans the amino acid sequence from region 532-699aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 42.8 kDa
UniProt: P12107
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal GST-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.