Mouse Becn1 protein

Artikelnummer: BYT-ORB383138
Artikelname: Mouse Becn1 protein
Artikelnummer: BYT-ORB383138
Hersteller Artikelnummer: orb383138
Alternativnummer: BYT-ORB383138-20,BYT-ORB383138-100,BYT-ORB383138-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Coiled-coil myosin-like BCL2-interacting protein
This Mouse Becn1 protein spans the amino acid sequence from region 1-448aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 67.6 kDa
UniProt: O88597
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYA
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.