Hamster GLUL protein

Artikelnummer: BYT-ORB383141
Artikelname: Hamster GLUL protein
Artikelnummer: BYT-ORB383141
Hersteller Artikelnummer: orb383141
Alternativnummer: BYT-ORB383141-20,BYT-ORB383141-100,BYT-ORB383141-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GS Glutamate decarboxylase Glutamate--ammonia ligase
This Hamster GLUL protein spans the amino acid sequence from region 2-373aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.2 kDa
UniProt: P04773
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNF
Anwendungsbeschreibung: Biological Origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.