Bacterial esxA protein

Artikelnummer: BYT-ORB383145
Artikelname: Bacterial esxA protein
Artikelnummer: BYT-ORB383145
Hersteller Artikelnummer: orb383145
Alternativnummer: BYT-ORB383145-20,BYT-ORB383145-100,BYT-ORB383145-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: esxA, SAS0258Type VII secretion system extracellular protein A, Ess extracellular protein A
This Bacterial esxA protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27 kDa
UniProt: Q6GCJ0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus (strain MSSA476)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain MSSA476). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.