Viral wac protein

Artikelnummer: BYT-ORB383146
Artikelname: Viral wac protein
Artikelnummer: BYT-ORB383146
Hersteller Artikelnummer: orb383146
Alternativnummer: BYT-ORB383146-20,BYT-ORB383146-100,BYT-ORB383146-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Collar protein Whisker antigen control protein
This Viral wac protein spans the amino acid sequence from region 2-487aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 67.7 kDa
UniProt: P10104
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Enterobacteria phage T4 (Bacteriophage T4)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTS
Anwendungsbeschreibung: Biological Origin: Enterobacteria phage T4 (Bacteriophage T4). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) wac.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) wac.