Bacterial ompA protein
Artikelnummer:
BYT-ORB383193
- Bilder (3)
| Artikelname: | Bacterial ompA protein |
| Artikelnummer: | BYT-ORB383193 |
| Hersteller Artikelnummer: | orb383193 |
| Alternativnummer: | BYT-ORB383193-20,BYT-ORB383193-100,BYT-ORB383193-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | MOMP |
| This Bacterial ompA protein spans the amino acid sequence from region 23-394aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 56.3 kDa |
| UniProt: | P06597 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLQTDVNKEFQMGAKPTTATGNAAAPSTCTARENPAYGRHMQDAEMFTNAAYMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENHATVSDSKLVPNMSLDQSVVELYTDTTFAWSAGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLDLKAGTDGVTGTKDASIDYHEWQASLA |
| Anwendungsbeschreibung: | Biological Origin: Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) ompA. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) ompA. |
Produktgarantie und fachkundiger Support
