Human HRH1 protein

Artikelnummer: BYT-ORB383289
Artikelname: Human HRH1 protein
Artikelnummer: BYT-ORB383289
Hersteller Artikelnummer: orb383289
Alternativnummer: BYT-ORB383289-20,BYT-ORB383289-100,BYT-ORB383289-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Short name, H1R Short name, HH1R
This Human HRH1 protein spans the amino acid sequence from region 211-416aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27.1 kDa
UniProt: P35367
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HRH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HRH1.