Bacterial clfA protein
Artikelnummer:
BYT-ORB383302
- Bilder (3)
| Artikelname: | Bacterial clfA protein |
| Artikelnummer: | BYT-ORB383302 |
| Hersteller Artikelnummer: | orb383302 |
| Alternativnummer: | BYT-ORB383302-20,BYT-ORB383302-100,BYT-ORB383302-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Fibrinogen receptor A Fibrinogen-binding protein A |
| This Bacterial clfA protein spans the amino acid sequence from region 228-558aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 52.1 kDa |
| UniProt: | Q6GB45 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Staphylococcus aureus (strain MSSA476) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQI |
| Anwendungsbeschreibung: | Biological Origin: Staphylococcus aureus (strain MSSA476). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial |



