Human CD35 protein

Artikelnummer: BYT-ORB383319
Artikelname: Human CD35 protein
Artikelnummer: BYT-ORB383319
Hersteller Artikelnummer: orb383319
Alternativnummer: BYT-ORB383319-20,BYT-ORB383319-100,BYT-ORB383319-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: anti C3 binding proteinprotein, anti C3b/C4b receptorprotein, anti C3BRprotein, anti C4BRprotein, anti CD 35protein, anti CD35protein, anti CD35 antigenprotein, anti complement component (3b/4b) receptor 1 (Knops blood group)protein, anti complement component (3b/4b) receptor 1 including Knops blood group systemprotein, anti Complement component receptor 1protein, anti Complement receptor 1protein, anti Complement receptor type 1protein, anti CR 1protein, anti CR1protein
This Human CD35 protein spans the amino acid sequence from region 41-234aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 48.4 kDa
UniProt: P17927
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal GST-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.