Mouse GP73 protein

Artikelnummer: BYT-ORB383325
Artikelname: Mouse GP73 protein
Artikelnummer: BYT-ORB383325
Hersteller Artikelnummer: orb383325
Alternativnummer: BYT-ORB383325-20,BYT-ORB383325-100,BYT-ORB383325-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: anti Golgi membrane protein 1protein, anti Golgi membrane protein GP73protein, anti Golgi phosphoprotein 2protein, anti Golgi protein 73 kDprotein, anti golgi protein 73kDprotein, anti GOLM 1protein, anti GOLM1protein, anti GOLPH 2protein, anti GOLPH2protein, anti GP 73protein, anti GP73protein
This Mouse GP73 protein spans the amino acid sequence from region 36-393aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56.6 kDa
UniProt: Q91XA2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAG
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Golm1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Golm1.