Human MFSD8 protein

Artikelnummer: BYT-ORB383374
Artikelname: Human MFSD8 protein
Artikelnummer: BYT-ORB383374
Hersteller Artikelnummer: orb383374
Alternativnummer: BYT-ORB383374-20,BYT-ORB383374-100,BYT-ORB383374-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Ceroid-lipofuscinosis neuronal protein 7
This Human MFSD8 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34.8 kDa
UniProt: Q8NHS3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-GST-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.