Fungi CDH-1 protein

Artikelnummer: BYT-ORB383383
Artikelname: Fungi CDH-1 protein
Artikelnummer: BYT-ORB383383
Hersteller Artikelnummer: orb383383
Alternativnummer: BYT-ORB383383-20,BYT-ORB383383-100,BYT-ORB383383-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cellobiose-quinone oxidoreductase
This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 22.3 kDa
UniProt: Q01738
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Anwendungsbeschreibung: Biological Origin: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.