Human PAEP protein

Artikelnummer: BYT-ORB383386
Artikelname: Human PAEP protein
Artikelnummer: BYT-ORB383386
Hersteller Artikelnummer: orb383386
Alternativnummer: BYT-ORB383386-20,BYT-ORB383386-100,BYT-ORB383386-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Placental protein 14 Short name, PP14 Pregnancy-associated endometrial alpha-2 globulin Short name, PAEG Short name, PEG Progestagen-associated endometrial protein Progesterone-associated endometrial protein
This Human PAEP protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 22.4 kDa
UniProt: P09466
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.