Rat Complement C3 protein

Artikelnummer: BYT-ORB383399
Artikelname: Rat Complement C3 protein
Artikelnummer: BYT-ORB383399
Hersteller Artikelnummer: orb383399
Alternativnummer: BYT-ORB383399-20,BYT-ORB383399-100,BYT-ORB383399-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Neutrophil chemotactic factor-2
This Rat Complement C3 protein spans the amino acid sequence from region 671-746aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 11 kDa
UniProt: P01026
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.