Mouse AUR1 protein

Artikelnummer: BYT-ORB383401
Artikelname: Mouse AUR1 protein
Artikelnummer: BYT-ORB383401
Hersteller Artikelnummer: orb383401
Alternativnummer: BYT-ORB383401-20,BYT-ORB383401-100,BYT-ORB383401-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Aurora-like kinase 1
This Mouse AUR1 protein spans the amino acid sequence from region 1-294aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 54 kDa
UniProt: Q9M077
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAIPTETQHQEKEASDASAAAAQKRWTLSDFDIGKPLGRGKFGHVYLAREKRSNHVVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAARGELYKDLQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGILCYEFLYGVPPFEAMEHSDTYRRIVQVDLKFPPKPIISASA
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.