Mouse Scgb3a2 protein

Artikelnummer: BYT-ORB383403
Artikelname: Mouse Scgb3a2 protein
Artikelnummer: BYT-ORB383403
Hersteller Artikelnummer: orb383403
Alternativnummer: BYT-ORB383403-20,BYT-ORB383403-100,BYT-ORB383403-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pneumo secretory protein 1
This Mouse Scgb3a2 protein spans the amino acid sequence from region 22-139aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 43.2 kDa
UniProt: Q920H1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-GST-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.