E. coli cdtB protein

Artikelnummer: BYT-ORB383412
Artikelname: E. coli cdtB protein
Artikelnummer: BYT-ORB383412
Hersteller Artikelnummer: orb383412
Alternativnummer: BYT-ORB383412-20,BYT-ORB383412-100,BYT-ORB383412-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Deoxyribonuclease CdtB (EC, 3.1.-.-)
This E. coli cdtB protein spans the amino acid sequence from region 19-269aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 47.4 kDa
UniProt: Q46669
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
Anwendungsbeschreibung: Biological Origin: Escherichia coli. Application Notes: E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.